PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G10740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 307aa    MW: 33440.3 Da    PI: 6.2433
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G10740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-334599155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OPUNC08G10740.1 45 RQRLRWTNELHDRFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 99
                     58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.75742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-3244100IPR009057Homeodomain-like
SuperFamilySSF466893.58E-184499IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-2646100IPR006447Myb domain, plants
PfamPF002498.1E-94798IPR001005SANT/Myb domain
PfamPF143791.5E-23131177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MYQPNPISSS GQTLGNPTAH EQMELGNNAM VPSNGGNNNP NMAARQRLRW TNELHDRFVE  60
AVTQLGGPDR ATPKGVLRIM GVPGLTIYHV KSHLQKYRLA KYIPDPSADD NKAEDKDPGN  120
LLSALEGSSG MQISEALKLQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQK IIEEQQRVMG  180
AGASRATSNE QLPDPERTNP PTPVPISESP VQGAPPSKNS RSQVEPTKSP SHDDALPCGE  240
PLTPDSSCQP GSPTLSPKHE RAAKRQRGSD VGDVTAFADG EFVLPHGIFE SSTGSEFQEC  300
SMPYSGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043960.0AP004396.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0404D10.
GenBankAP0044590.0AP004459.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0410E11.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648505.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A0E0LU260.0A0A0E0LU26_ORYPU; Uncharacterized protein
STRINGLOC_Os08g25820.10.0(Oryza sativa Japonica Group)
STRINGORGLA08G0104600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-78G2-like family protein